PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AA40G00449
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Aethionemeae; Aethionema
Family MYB
Protein Properties Length: 301aa    MW: 34838.8 Da    PI: 4.7802
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
AA40G00449genomeVEGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding44.73.1e-141461148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+WT eEd++l++ +   G  +W++ ++  g+ R++k+c++rw +yl
       AA40G00449 14 KGPWTVEEDKKLINFILTNGHCCWRALPKLSGLLRCGKSCRLRWINYL 61
                     79******************************99************97 PP

2Myb_DNA-binding513.3e-1673111747
                      HHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   7 eEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                       E++  +d+++qlG++ W++Ia++++ gRt++++k++w+++
       AA40G00449  73 YEEQMVIDLHAQLGNR-WSKIASHLP-GRTDNEIKNHWNTH 111
                      599*************.*********.************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.602.1E-19562IPR009057Homeodomain-like
PROSITE profilePS5129412.534961IPR017930Myb domain
SuperFamilySSF466892.55E-2611108IPR009057Homeodomain-like
SMARTSM007174.2E-111363IPR001005SANT/Myb domain
PfamPF002491.4E-121461IPR001005SANT/Myb domain
CDDcd001671.55E-71661No hitNo description
PROSITE profilePS5129425.94862116IPR017930Myb domain
Gene3DG3DSA:1.10.10.601.0E-2463117IPR009057Homeodomain-like
SMARTSM007176.7E-1466114IPR001005SANT/Myb domain
PfamPF002498.8E-1473111IPR001005SANT/Myb domain
CDDcd001672.59E-1074112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009737Biological Processresponse to abscisic acid
GO:2000652Biological Processregulation of secondary cell wall biogenesis
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 301 aa     Download sequence    Send to blast
MGRQPCCEKV GLKKGPWTVE EDKKLINFIL TNGHCCWRAL PKLSGLLRCG KSCRLRWINY  60
LRPDLKRGLL SDYEEQMVID LHAQLGNRWS KIASHLPGRT DNEIKNHWNT HIKKKLKKMG  120
IDPLTHKPLF QQEVSLQENQ HNDDKNPKED QETNQENQLE QSDGFCIDEV PLMDPHEILI  180
DIHHTNDNVN INISNSAISP SSSSSSSSSS CITSIQDDRF SKFLEEIEFL DLKWFLSDDD  240
DSSKDKVFDN IDDNNVDMMN FWDINDLSNV DHNDHDDNNG FVVNECSRMV LDQDSWTFDH  300
L
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A4e-27121165108B-MYB
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00513DAPTransfer from AT5G16600Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_197163.11e-140myb domain protein 43
SwissprotQ50EX64e-82ODO1_PETHY; Protein ODORANT1
TrEMBLQ9SPG71e-140Q9SPG7_ARATH; MYB transcription factor
STRINGAT5G16600.11e-139(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM4282646
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G16600.11e-116myb domain protein 43